Connecting linkedin

AI recruitment tools

over 4 years ago by Neil Pickstone

W1siziisijiwmtgvmdqvmduvmdgvndcvndcvmji5l3nodxr0zxjzdg9ja181mjkyotkymteuanbnil0swyjwiiwidgh1bwiilciymjawedywmfx1mdazyyjdlfsiccisim9wdgltaxplil1d

There's no denying that we are moving towards a future where artificial intelligence will be relied upon for the majority of businesses. 

But there is an important element of the the recruitment industry that is not feasible to outsource to A.I.

The process of hiring and recruiting involves much more than sifting through CVs and arranging candidate interviews, indeed the notion of human interaction has never been more important than during the interview process. How a candidate engages and connects with the interviewer is vital; without experiencing this the interviewer cannot gauge if the candidate is the best hire for the company. 

Regardless of the variety of A.I. tools that will inevitably become mainstream in the coming years, interviewing will remain in the domain of the human. 


Contact us for details of our recruitment technology. 



6 MONTHS AGO BY NEIL PICKSTONE

W1siziisijiwmtgvmdivmtivmtyvndgvmtavntcvqxdhcmqgz2xhc3mgdhjvcgh5iepqry5qcgcixsxbinailcj0ahvtyiisijqwmhgzmdbcdtawm2mixsxbinailcjvchrpbwl6zsjdxq

Award writing is unlikely to be at the top of a busy recruiter’s agenda, however entering awards brings tangible benefits to your business. With many award options from local to national as well as recruitment industry awards, there is sure to be ...

READ MORE

7 MONTHS AGO BY NEIL PICKSTONE

W1siziisijiwmtgvmdevmjkvmdkvmtqvndcvmtm0l1jbrsbzdxjnzxj5ihnpz24uanbnil0swyjwiiwidgh1bwiilci0mdb4mzawxhuwmdnjil0swyjwiiwib3b0aw1pemuixv0

Volcanic is delighted to announce the expert panel line up at the Digital Marketing Surgery at RAE The Digital Marketing Surgery on stand F11, staffed by leading independent consultants, is offering free advice on different aspects of running a su...

READ MORE

7 MONTHS AGO BY NEIL PICKSTONE

W1siziisijiwmtgvmdevmjqvmtqvntcvmzqvnja0l0vydxb0ie5xlmpwzyjdlfsiccisinrodw1iiiwindawedmwmfx1mdazyyjdlfsiccisim9wdgltaxplil1d

Every recruitment website should function as a management tool within the new data protection climate Making your recruitment website work hard will help you manage data effectively while protecting the rights of every data subject. Following my p...

READ MORE

7 MONTHS AGO BY NEIL PICKSTONE

W1siziisijiwmtgvmdevmjuvmtyvmtgvmzevnzgzl0nvbnn1bhrhbmn5igltywdllmpwzyjdlfsiccisinrodw1iiiwindawedmwmfx1mdazyyjdlfsiccisim9wdgltaxplil1d

Volcanic is launching a Digital Marketing Surgery at next week’s Recruitment Agency Expo Staffed by leading consultants in their respective fields, the drop-in surgery at stand F11 will offer free expert consultancy to all visitors to the RAE. Exp...

READ MORE